PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG340400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 481aa    MW: 50729.2 Da    PI: 6.7529
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG340400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS353.24e-108654361374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                          lv+lL++cA a+++gd ++a  +L++ +   a+ +  + + R+a +f+ ALa+rla   ++ +   pp        ++++  ++ f+++ 
  Pavir.1KG340400.1.p  65 LVHLLVTCAGAIQAGDYSAAGDYLTQARSFlAAITSsTGIGRVARHFVDALAQRLAPAHPQQA--PPPP------PATAAELHSHFYDAG 146
                          68*************************998755555499*****************9333222..2222......2333444556***** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                          P+lkf++ taNqaIl+a+eg++rvH++D+ ++qGlQWpaL++aL++R++gpp+lRiTg+g       +el e+g rL+++A++l+vpf f
  Pavir.1KG340400.1.p 147 PYLKFAYSTANQAILDAFEGCDRVHVVDLALMQGLQWPALIDALSQRRGGPPHLRITGIGG----AGDELGEVGARLEQLARSLDVPFTF 232
                          *************************************************************....99*********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                          +v+ +++l+ l+ ++L v pgEalaVn+vlqlhrll ++ + +    ++d++L lv sl+P+v++vveqeadhn++ ++erf++al +y+
  Pavir.1KG340400.1.p 233 RVVRVDQLDGLRRWMLGVVPGEALAVNSVLQLHRLLVDPDADPAvpaPIDALLYLVTSLQPRVFTVVEQEADHNRPALVERFTNALFHYA 322
                          ***********************************9665554444449****************************************** PP

                 GRAS 266 alfdsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll.rk..vksdgyr 350
                          a+fds+ea  +r+    + + + +++l+ ei +vv+ eg++r erhe +++Wr+rl +aG++++p++ +++  a + l r+  ++  gy 
  Pavir.1KG340400.1.p 323 AMFDSMEAASHRTGggGTTSALAEACLRAEILDVVCGEGSARAERHEPVGRWRKRLARAGLTQLPVGADEVRRATAQLiREtlFSATGYG 412
                          ******999999988899999**********************************************99998887655243224589*** PP

                 GRAS 351 veeesgslvlgWkdrpLvsvSaWr 374
                          v e  gsl l W+drpL++++aWr
  Pavir.1KG340400.1.p 413 VLECAGSLALAWHDRPLYAATAWR 436
                          ***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.37839413IPR005202Transcription factor GRAS
PfamPF035141.4E-10565436IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MDPAAAAAAA ATGNLPSPFS AAAANGHVYY YLDPALYASV VPPVIPTAAE VARRRQEEEN  60
AGIRLVHLLV TCAGAIQAGD YSAAGDYLTQ ARSFLAAITS STGIGRVARH FVDALAQRLA  120
PAHPQQAPPP PPATAAELHS HFYDAGPYLK FAYSTANQAI LDAFEGCDRV HVVDLALMQG  180
LQWPALIDAL SQRRGGPPHL RITGIGGAGD ELGEVGARLE QLARSLDVPF TFRVVRVDQL  240
DGLRRWMLGV VPGEALAVNS VLQLHRLLVD PDADPAVPAP IDALLYLVTS LQPRVFTVVE  300
QEADHNRPAL VERFTNALFH YAAMFDSMEA ASHRTGGGGT TSALAEACLR AEILDVVCGE  360
GSARAERHEP VGRWRKRLAR AGLTQLPVGA DEVRRATAQL IRETLFSATG YGVLECAGSL  420
ALAWHDRPLY AATAWRATGA GDASGGGAAA ASGERDDKGR RRNSRNGSGE SNGRGNRATA  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-42654364375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.167126e-58stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963578.10.0PREDICTED: DELLA protein DWARF8-like
TrEMBLK3ZCZ80.0K3ZCZ8_SETIT; Uncharacterized protein
STRINGSi024429m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-75RGA-like 1